PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03198.2.p
Common NameEUGRSUZ_G03198
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YC
Protein Properties Length: 205aa    MW: 23012.6 Da    PI: 8.8535
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03198.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC54.72.3e-171762398
             NF-YC 23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      +arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl +iv r
  Eucgr.G03198.2.p  1 MARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNSLHLKHCVQSYNVFDFLREIVSR 76
                      69**********************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008088.8E-18161IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.0E-23176IPR009072Histone-fold
SuperFamilySSF471131.56E-19877IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK TMNSLHLKHC  60
VQSYNVFDFL REIVSRVPDY GHGHGHSDAV SEDRTVSRRR KATIDDGNDT DEESKKSRMP  120
ILAAVAEEEA VAEEEAAGVV AEPLRGRLRT MKLNHLSRPH LCNLSTRTLS IKEQFQITAL  180
SQRKLLRKLS QPLMVPSLER MVLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-192621575Transcription Regulator NC2 alpha chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03198.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067677.17e-82PREDICTED: dr1-associated corepressor
TrEMBLA0A059BI131e-149A0A059BI13_EUCGR; Uncharacterized protein
STRINGGLYMA15G36170.16e-71(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.14e-64nuclear factor Y, subunit C11